SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc02g086360.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g086360.2.1
Domain Number 1 Region: 44-141
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.56e-17
Family PB1 domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc02g086360.2.1
Sequence length 557
Comment genomic_reference:SL2.40ch02 gene_region:43601058-43604121 transcript_region:SL2.40ch02:43601058..43604121- go_terms:GO:0055114 functional_description:"Octicosapeptide/Phox/Bem1p domain-containing protein (AHRD V1 *--- D7L8F8_ARALY); contains Interpro domain(s) IPR000270 Octicosapeptide/Phox/Bem1p "
Sequence
MDPPSPAPPSTATDSLLDLPPLPTPTTKVRLLCSYGGQIVQRPHDKTLCYAGGENRVVAV
DRRTTISSLSALLAHLSRTLYGNRPFYLKYQLPDEELDSLISVTTDEDLQNMLEEHDRTT
TASVTSSRIRLFLFPVKPESLGSALLDSKADSWFSDALNNTWIARRGQSTDSGFGHELIG
FENLGGSNSVVSSEGQGDNLSAIGGSAGDAKQTLDFGGGSVPESMVLETSSSFGSTSSSI
SMSNMPAIGVQAEDGGVNLQDKRVRVPSSSASIESDSIMGGAGFQPKVGIHQEPLIQVMS
SMASHSLFEAEGSNASPSLIQTPKMVQVSGYPLPQTLDGKQPQPGIQYVHGGACYVPHYP
SGPLPVSSCYPFYQVPMQQPQQTPYPLNQQYPIYLVPVQQMQSHSMSVLPNINHAAVMAS
NRPPLHSQSVINPPSVAYKEVMAAQSVPESGPKVYTTVPTASLPISAPSQTQQQYTVLPE
PQLTSQPVSTASVPAANDANEFDDDLAYNQIYKSQPPPPSFISQCQTITKGAAVLLSESS
MQMHSNNVMNQAPSHPQ
Download sequence
Identical sequences K4BBE4
XP_004232331.1.44838 Solyc02g086360.2.1 Solyc02g086360.2.1 Sopim02g086360.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]