SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc02g087420.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc02g087420.1.1
Domain Number - Region: 14-135
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000293
Family FCH domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc02g087420.1.1
Sequence length 222
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch02 gene_region:44453556-44456360 transcript_region:SL2.40ch02:44453556..44456360+ functional_description:"Genomic DNA chromosome 3 P1 clone MFJ20 (AHRD V1 ***- Q9LSJ7_ARATH)"
Sequence
MAGNDSQKQFLTLLREFASEKSQGERRIVNHKKRNQQLQSELQLAYAEVEEAKNQKETAE
QELKVYEVELARNESAIQTLEEGILWIQDELSAYGSNVESLKNKEAETRDDFIEKMFELN
AQIRKFHESIASIFRNDDCSTSASKPGSAKAKAEDAEAFKGDLQNKLAQIVSQITKEEEE
YQVEQNIHRQVAEELNILESKASLIEGITKENMEMQELARYP
Download sequence
Identical sequences K4BBP9
Sopim02g087420.0.1 Solyc02g087420.1.1 XP_004233696.2.44838 Solyc02g087420.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]