SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc03g113410.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g113410.1.1
Domain Number 1 Region: 106-187
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000000378
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc03g113410.1.1
Sequence length 199
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch03 gene_region:57616872-57617695 transcript_region:SL2.40ch03:57616872..57617695+ go_terms:GO:0003700 functional_description:"Auxin response factor 9 (AHRD V1 *-** D7R605_SOLLC); contains Interpro domain(s) IPR011525 Aux/IAA-ARF-dimerisation "
Sequence
MDKIMEEEDSFHSNTDAIIYPISDVSQSLLSDPNIASSPSTSADDQQQQPHQWTTAAAAA
VGYSNDDLSVSVSVSSACSRISYKQIDKDQIDVSKAKERVQLPKDFTSSRSRIKVHMQGV
AVGRSVDLTVLRGYDELISVVEEIFDIKGELSPRIKWQLVYRDDEGDMMLVGDYPWPEFC
EMVRKLYIYSREEVKKKYS
Download sequence
Identical sequences K4BKJ3
XP_004236521.2.44838 Solyc03g113410.1.1 Solyc03g113410.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]