SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc04g077100.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc04g077100.2.1
Domain Number 1 Region: 298-428
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.74e-20
Family ADP-ribosylating toxins 0.08
Further Details:      
 
Domain Number 2 Region: 90-144
Classification Level Classification E-value
Superfamily WWE domain 0.0000379
Family WWE domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc04g077100.2.1
Sequence length 434
Comment genomic_reference:SL2.40ch04 gene_region:59650175-59651874 transcript_region:SL2.40ch04:59650175..59651874+ go_terms:GO:0003950 functional_description:"Poly polymerase catalytic domain containing protein expressed (AHRD V1 **-- Q336N3_ORYSJ); contains Interpro domain(s) IPR012317 Poly(ADP-ribose) polymerase, catalytic region "
Sequence
MSTAPAGSCAPMIASGEMDSVSAVLNGNKVEILVPLERTAGGSGKKVRVEVPRNWLIPSA
RSTDHAQLLVQNHQNFKVSGMPARIMMFKDGSWVDFEKSAMDVLVSAFVSGEAMVETVMG
GFTFIFDFYRMIGINLDSGNELPIAWIDVGGNSFYPKVFVEGSENLDKNEVNVDEKFSSE
NGKVEFEIKIIERNSAGEVLGKRKMGSEENEVVREVGSSSRDVIEQRVVSTPTELLPPKW
PRTRSLGNEEESYRKASSLLISILKVGVTVTAVHQCTRTGPVEQARLEVFVNNAKIVKRR
RGDPSVQYAWYGTSSAKIDSIMRRGFEMPRIIPGIQTHGVGIYMSPLYSPQKSHMMCEVD
ENGEKHIMLCRVIVGKLEKVELGSQQLFPSSAEFDTGVDDLINPKLHVIWCSNMNTHILP
IFIVSYKSGCHMSG
Download sequence
Identical sequences K4BUE7
XP_010320246.1.44838 XP_010320249.1.44838 XP_010320254.1.44838 XP_010320258.1.44838 XP_019069201.1.44838 XP_019069202.1.44838 XP_019069203.1.44838 XP_019069204.1.44838 XP_019069205.1.44838 XP_019069206.1.44838 XP_019069207.1.44838 XP_019069209.1.44838 XP_019069210.1.44838 XP_019069211.1.44838 XP_019069212.1.44838 XP_019069213.1.44838 Solyc04g077100.2.1 Solyc04g077100.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]