SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc08g008410.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc08g008410.2.1
Domain Number 1 Region: 912-998
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.27e-20
Family PB1 domain 0.006
Further Details:      
 
Weak hits

Sequence:  Solyc08g008410.2.1
Domain Number - Region: 388-456
Classification Level Classification E-value
Superfamily GAF domain-like 0.00471
Family GAF domain 0.019
Further Details:      
 
Domain Number - Region: 206-272
Classification Level Classification E-value
Superfamily GAF domain-like 0.0051
Family GAF domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc08g008410.2.1
Sequence length 1008
Comment genomic_reference:SL2.40ch08 gene_region:2829724-2834799 transcript_region:SL2.40ch08:2829724..2834799+ go_terms:GO:0003700 functional_description:"Nodule inception protein (Fragment) (AHRD V1 *-*- B4ER15_MEDTR); contains Interpro domain(s) IPR003035 Plant regulator RWP-RK "
Sequence
MSEPGGGMTQNHLPKSKELTPATVTERESMMMDLDFDIDASWSFDQIFAAAAAVSSNPAS
PFLPCSPLWAFPDDNDEKPAGNGLSGALRISGHPRFVAYTGDLEATTETISVNTDKGRLT
SPISGLLPGDNPEGSCIIKERMTQALRYLKETSGERVLAQVWAPVKEAGRSVLTTSGQPF
VLDPECNGLHQYRTVSLMYMFAADGETDGVLGLPGRVFRLKLPEWTPNVQYYSSKEFPRL
DHALNYNVRGTLALPVFEPSGRSCVGVLELIMTSQKINYAAEVDKVCKALEAVNLKSSDI
LDHPNTQVYVMGYMNQICNEGRQNALVDILEILTAVCETYKLPLAQTWVPCRHRSVLADG
GGLRKSCSSFDGSCMGQICMSTTDVAFYVVDAHMWGFRDACAEHHLQRGQGVAGRAYASR
KSCYCEDITQFCKTEYPLVHYARMFGLTSCFAICLRSSHTANDDYILEFFLPPNSGDYSD
QPALLNSLLLTMKQHFRSLSIASGEELEHDWGSVEIIQASMEEKIDAKPESVPTAKTSPQ
LTSLPNGWVHLDPVGEQQSAVGSNVSKGARSTSGTGEAPNNVSNSDNKTSGKKSERKRGK
AEKTISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKVNRSLSKLK
CVIESVQGAEGAFTLTSLAPNSLPAAVSSISWPAGANVSNLPSSPSSKPSVFPEEKNEFF
HHGTPESHIEAEPSNQMLGGRVARKEEFTPMQNGFLHAEGTHKSRTGSVSREESAGTPTS
HGSCQGSPCAGNGFSPQNELVNSPAHESCMKVGGSLEAARQTTAEINLSSAFLMPQPIIP
KHTQEPFGGMLVEDAGSSHDLRNLCSPRDALVDERVPDYNLTNPPFSDAIAKDPVYVPPD
TIQQYSAWPEVTSVTIKATYKEDIIRFRLCLSSGIVKLKEEVAKRLKLELGTFYIKYLDD
DLEFVPISCDADLQECVDISRSSGSSIVRLLIHDIMSNLGSSCESSGK
Download sequence
Identical sequences K4CIX5
XP_004244640.1.44838 Solyc08g008410.2.1 Solyc08g008410.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]