SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc10g078750.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc10g078750.1.1
Domain Number 1 Region: 161-237
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 2 Region: 257-289
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000693
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 94-124
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000235
Family CCCH zinc finger 0.0026
Further Details:      
 
Domain Number 4 Region: 35-61
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000235
Family CCCH zinc finger 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc10g078750.1.1
Sequence length 293
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch10 gene_region:59800183-59803268 transcript_region:SL2.40ch10:59800183..59803268+ go_terms:GO:0003723,GO:0008270 functional_description:"Zinc finger CCCH domain-containing protein 14 (AHRD V1 ***- C3H14_ORYSJ); contains Interpro domain(s) IPR018111 K Homology, type 1, subgroup "
Sequence
MDFRKRSRNGAGSNFNGGLKKSKPEMDSLSGGIGSKTKPCTKFFSIAGCPFGESCHFLHH
VPGGYNAVAQMMNLGSAPASRNVAAPPMSNGNAPAVKTKLCNKFNTAEGCKFGDACNFAH
GEWQIGKPIVPSQEDPRAMGVGPAPSRFGGRTEPAVSGPASSFGTTATAKISVDASLAGA
IIGKGGVNSKQICRQTGAKLAIREHETDTNLRNIELEGTFEQISQASAMVRELINSLGPV
GGPGRDPAGRGGPAPPMNNYKTKLCENFAKGSCTFGDRCHFAHGDAEMRKTGV
Download sequence
Identical sequences K4D2B7
Sopim10g078750.0.1 Solyc10g078750.1.1 Solyc10g078750.1.1 XP_010312058.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]