SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc00g007030.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc00g007030.1.1
Domain Number 1 Region: 103-235
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.82e-22
Family Glutathione S-transferase (GST), C-terminal domain 0.016
Further Details:      
 
Domain Number 2 Region: 23-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.06e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc00g007030.1.1
Sequence length 239
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch00 gene_region:6622946-6626691 transcript_region:SL2.40ch00:6622946..6626691- functional_description:"Glutathione S-transferase (AHRD V1 ***- Q76KW1_PEA); contains Interpro domain(s) IPR004046 Glutathione S-transferase, C-terminal "
Sequence
MASSSVQDLLPPSLDSTSQPPSLFDGTTRLYINYQCPYSQRVWITRNVKGLQDMIKLVPI
DLQNRPDWYKEKVYPKNKVPSLEHNNKVIGESFVLVKYVDYNFEGPSFMPDDQEKQKFAE
ELIAYSDTTFVPEVYRSFAKDARKLAGAQFDYLEKALHKFDDGPFFLGQFSQVDIIYAPF
IERFHVFMPEGFNYDITTGRPKLAKWIEEMNNLDGYKQTKVLEQEKMVEYYKNRFLPKA
Download sequence
Identical sequences XP_004253250.2.44838 Solyc00g007030.1.1 Sopim00g007030.0.1 Solyc00g007030.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]