SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc01g015210.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g015210.1.1
Domain Number 1 Region: 4-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-18
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 179-272
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000942
Family B3 DNA binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc01g015210.1.1
Sequence length 284
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch01 gene_region:17899936-17901263 transcript_region:SL2.40ch01:17899936..17901263+ go_terms:GO:0006355 functional_description:"B3 domain-containing protein At1g49475 (AHRD V1 *-*- Y1475_ARATH); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MVNSSSNYPNFIKIICSSDELCHLRNPLVFAKSHCKNMLSPVFLESPHGKSWEVEVIMSQ
DEIWIAKGWKSFCPYYSISVKSLLMFTYIPCSHFDVTIYDQSTSIIEYPIHQDIEVDEEE
DVIPFFQYNAIAIEEDIPVYLQANANVIEQDKEVGEANSRSEQVNPKIYRSLHNLLNING
DKLHFEMVIKKAHSTYMTIPLRYSQGTYIINMANMRLVSEEGEEWRVDIGYNAGKVIIKG
GWSAFQKDNKISNGETWRFKLIRGPIANVLQVHKNPTLLLIATN
Download sequence
Identical sequences K4AUF5
Solyc01g015210.1.1 Solyc01g015210.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]