SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc01g066860.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc01g066860.2.1
Domain Number - Region: 82-138
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.0262
Family ADP-ribosylating toxins 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc01g066860.2.1
Sequence length 155
Comment genomic_reference:SL2.40ch01 gene_region:67453578-67454383 transcript_region:SL2.40ch01:67453578..67454383- functional_description:"Unknown Protein (AHRD V1)"
Sequence
MADSNYVDREKQKQADNDIKDMISSLTKRLAGLQRVHKASGGDSGQNLQGDDEDDHGTRI
ITLAGTNVGASMRGEMDEKAGIEGVSPGENEALKTYVNSNFQSINNSIMMGGSYCTNDPG
VHLDITDRVDEQLPKPQGYKHKKGKKSDHHYEHSE
Download sequence
Identical sequences K4AWT6
Sopim01g066860.0.1 Solyc01g066860.2.1 XP_010321742.1.44838 Solyc01g066860.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]