SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc01g079560.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g079560.2.1
Domain Number 1 Region: 11-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-16
Family B3 DNA binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc01g079560.2.1
Sequence length 109
Comment genomic_reference:SL2.40ch01 gene_region:71142573-71144461 transcript_region:SL2.40ch01:71142573..71144461+ go_terms:GO:0006355 functional_description:"B3 domain-containing protein Os11g0197600 (AHRD V1 ***- Y1176_ORYSJ); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MSNFGGNPNDELSFYKIVLDPRMEELRVPSTLVNRMREETMGEVLLKCGDGDKYWNITTR
EDGNSMYFHGGWKEFALENHIQMTQVLFFNYDGAKTFTVRIFDKNGLEK
Download sequence
Identical sequences K4AXK1
Solyc01g079560.2.1 XP_004229559.3.44838 Solyc01g079560.2.1 Sopim01g079560.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]