SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc01g096070.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g096070.2.1
Domain Number 1 Region: 107-244
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.16e-39
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 569-650
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000000736
Family PB1 domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc01g096070.2.1
Sequence length 689
Comment genomic_reference:SL2.40ch01 gene_region:78941748-78946012 transcript_region:SL2.40ch01:78941748..78946012+ go_terms:GO:0003700,GO:0008022 functional_description:"Auxin response factor 9 (AHRD V1 **** D7R605_SOLLC); contains Interpro domain(s) IPR010525 Auxin response factor "
Sequence
MNLGMGTEDLYRDLWKACAGPLVDVPREGERVYYFPQGHIEQLEASTNQAVNQQIPQFNL
ASKILCHVFHVQLLAETETDEVYAQITLHPEAEQEEPSKPDPCPPDLPKRTVHSFCKILT
ASDTSTHGGFSVLRKHANECLPQLDMTQATPTQDLVAKDLHGYEWRFKHIFRGQPRRHLL
TTGWSTFVTSKRLVAGDAFVFLRDDSGELRVGVRRLARQQSPIPQSVISSQSMHLGVLAT
ASHAITTQTRFVVYYKPRTSQFIVGLNKYLEAVSHGFSVGMRFRMRFEGEDSPERRFTGT
IVGTGDISSQWSESKWRSLKIQWDEPASMVRPDRVSPWEIEPFVASTCVDVAQPGIKSKR
PRPLDLPRSEIAVASAASPFWCPGSGLTLEVSHLGGITEVQSRDNQLFWSSKQSSSLSNG
MSNTSCRTHLSGAWQHNMLANGSLNLLRDSIEDNKQLITRSALLDYGSPMSSRVSSGLLH
DQVNRGSKHVISSACRLFGIDLRNNSNNTPSKAKEMLGPNITSNCADEAPVVHDESEVDK
DQNVGHLNPSEEKKQFQLEALPKDTQKQGPTSSRTRTKVQMEGVCVGRAVDLTALSGYDD
LISELEKIFDIKGELCPRNKWEVVYTDDEGDMMLVGDDPWLEFCKMVRRIFIYSSEEVKK
MTPRCKLPILSLEGEGTMPSVDSELKAEG
Download sequence
Identical sequences K4AZZ6
Solyc01g096070.2.1 Solyc01g096070.2.1 Sopim01g096070.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]