SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc02g032210.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g032210.1.1
Domain Number 1 Region: 182-294
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000294
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc02g032210.1.1
Sequence length 300
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch02 gene_region:18715960-18716862 transcript_region:SL2.40ch02:18715960..18716862- functional_description:"B3 domain-containing protein At1g05920 (AHRD V1 *-*- Y1592_ARATH); contains Interpro domain(s) IPR005508 Protein of unknown function DUF313 "
Sequence
MSLLSNSFSIYLCLWRFSFSMGIVNEDDGGGGGRKEESCITDSECECVDDEEHEKDETFR
KNPYMCEHSVEHYYYLLPRARRSKIFTRKKPLIVIPSQSTSQEKGLEIRNSLKRKTNEIV
DVGLPMEKKKTENLFDEKQSKSEDAKKKRRKVKPIIDPPVLPDELKEKISGMGVQISQVK
LVIQKALYDTDLSYQQMRLSIPVNQVVSKDFLTPQQKMVLETKNVSNKKTKIQFNLIEPS
LEQTKIHLTKWDRSNSSSYVLLNNWMQVVERNKLKPEMVVQLWSFHQHLVPWLALVLVPI
Download sequence
Identical sequences K4B5G7
XP_004231678.2.44838 Solyc02g032210.1.1 Solyc02g032210.1.1 Sopim02g032210.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]