SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc02g080730.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g080730.1.1
Domain Number 1 Region: 23-79
Classification Level Classification E-value
Superfamily Homeodomain-like 6.81e-16
Family GARP response regulators 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc02g080730.1.1
Sequence length 270
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch02 gene_region:39458096-39459638 transcript_region:SL2.40ch02:39458096..39459638+ go_terms:GO:0045449 functional_description:"Myb family transcription factor (AHRD V1 *--- D7LIV0_ARALY); contains Interpro domain(s) IPR006447 Myb-like DNA-binding region, SHAQKYF class "
Sequence
MELGNNNSDKSSEFFIRAYVKPKMPRLRWTDDLHRRFVHAVDHLGGVDRATPKMVLQIMN
VKGVTISHIKSHLQMYRSLKHQEMQAEAANGRKRNRIDASDSMNNLWANLVHRYNHINGK
AAVIDGSDQMNFPQGNLVNGYNHIKGKAAMFDGSNQMNFPQGNLIHCYNHNNRKAPIFNG
SNQMNISQGNLVHCYNHNNGKAPIINGSNQMNFPQGNLVQRYNHNNGKSVFDGHLNPTVT
TNYLEKIASSSTVFPPPWFVSFFFSSFFLX
Download sequence
Identical sequences K4B9U4
Solyc02g080730.1.1 Solyc02g080730.1.1 Sopim02g080730.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]