SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc02g090170.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g090170.2.1
Domain Number 1 Region: 22-123
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.02e-21
Family B3 DNA binding domain 0.0042
Further Details:      
 
Domain Number 2 Region: 253-342
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-19
Family B3 DNA binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc02g090170.2.1
Sequence length 366
Comment genomic_reference:SL2.40ch02 gene_region:46379891-46381662 transcript_region:SL2.40ch02:46379891..46381662+ go_terms:GO:0006355 functional_description:"B3 domain-containing protein LOC_Os12g40090 (AHRD V1 ***- Y1209_ORYSJ); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MATICERCKVLEKQKYWEEFDKQHKFFKIMINDFRRRLRIPQKFVTCFKNSHKLLGQKIL
TGPSGNTWLVEVIRTEKDYVFCNGWEVFVKDHSLEIADMLVFKMDGFSAFDVMIFDASAC
EKETTFFVKKNRNPCKHPDEVTDEHTTEQQSSEDEPSNDDDVTDEDDNIQEPTRGRKSSR
GKQYQFQSLQSSKGKKMKKILVAKQDNRRRKCTPMSSRKKNVEPEEKRPMYSNRRRVSEK
EKMRVHQLASRHTSSVPSLLMTMQPTHVYMGQLKLPKEWAQKNMRKISETITLRIPSSRR
TWSASIRCRMEGLVIQSGWDDFAMDNDLEEFDICVFELAQGGKHDSKPVILDVYIYPVEN
EIMRPL
Download sequence
Identical sequences K4BCG8
Solyc02g090170.2.1 Solyc02g090170.2.1 XP_004233644.1.44838 Sopim02g090170.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]