SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc05g054760.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc05g054760.2.1
Domain Number 1 Region: 84-208
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.36e-23
Family Glutathione S-transferase (GST), C-terminal domain 0.0034
Further Details:      
 
Domain Number 2 Region: 19-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.28e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc05g054760.2.1
Sequence length 210
Comment genomic_reference:SL2.40ch05 gene_region:63753656-63758079 transcript_region:SL2.40ch05:63753656..63758079- go_terms:GO:0045174 functional_description:"Dehydroascorbate reductase (Fragment) (AHRD V1 ***- Q1G0W3_SOLLC); contains Interpro domain(s) IPR017933 Glutathione S-transferase/chloride channel, C-terminal "
Sequence
MVVEVCVKAAVGAPDVLGDCPFSQRVLLTLEEKKVTYKKHLINVSDKPKWFLEVNPEGKV
PVINFGDKWIPDSDVIVGIIEEKYPNPSLIAPPEFASVGSKIFPTFVSFLKSKDSSDSTE
QALLDELKALEEHLKAHGPYINGQNVCSVDMSLAPKLYHLEVALGHFKKWSVPESLSHVR
NYMKLLFERESFQKTKAEEKYVIAGWAPKV
Download sequence
Identical sequences K4C2F3
Sopim05g054760.0.1 Solyc05g054760.2.1 NP_001234822.2.44838 Solyc05g054760.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]