SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc06g073980.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g073980.2.1
Domain Number 1 Region: 85-181
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000235
Family B3 DNA binding domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc06g073980.2.1
Sequence length 184
Comment genomic_reference:SL2.40ch06 gene_region:42117163-42120125 transcript_region:SL2.40ch06:42117163..42120125+ go_terms:GO:0006355 functional_description:"Unknown Protein (AHRD V1); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MVTPVEHVSIPHDLPEFFKIFHPEICYPQLFYVKIYGKNGCLKEDVTALKEPELLPLVEE
KARGKSIVAEPADQTDNGSGDMASSVTSFEIVIKASHLNRARLNLPAPFGNCYLKRKKRP
LMATLRTDSGSWTIVPQYYDRLELREGIQKFIDDNALRVNDVCRFKLIDDEKLILKVRIK
RQPK
Download sequence
Identical sequences K4C9B6
Solyc06g073980.2.1 Solyc06g073980.2.1 Sopim06g073980.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]