SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc06g075150.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g075150.2.1
Domain Number 1 Region: 93-205
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.59e-28
Family B3 DNA binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc06g075150.2.1
Sequence length 671
Comment genomic_reference:SL2.40ch06 gene_region:43020594-43023443 transcript_region:SL2.40ch06:43020594..43023443+ go_terms:GO:0046982,GO:0005516 functional_description:"Auxin response factor 16 (AHRD V1 ***- D9IVB4_SOLLC); contains Interpro domain(s) IPR010525 Auxin response factor "
Sequence
MEVVEEKCVDSLFWHVCTGSMVQIPPVNSKVFYFPQGYAEHTFTNVDFTVLARIPAMILC
RVDAVKFLADTETDEVYAKIRLIPVEDFEDDSVVEETEKPAFFAKTLTQSDANNGGGFSV
PRYCAETIFPKLDFTADPPVQVVKAKDVHGVTWNFRHIYRGTPRRHLLTSGWSAFVNKKK
LVAGDSVVFVKAENDELCVGIRRVKRGGIGGPETQSGWKSTACSYGGFVTEDENSSTNGN
LISYGERFRDKGKVSPDEVVRASCLAANGQPFEIVYYPGASTPEYCVKASSVRAAMSVQW
CSGMRFKMAFETEDFSQISWFMGSISSVQVVDPIRWPHSLWRLLQVTWDEPDLLQNVKSV
NPWLVELVSNMPDINLSHNSPPRKRLCLPQEFPFDGQFPLPSFSGNPLTSSSYSRYPSDS
ITAGIQGARHVRFGVPLLDLHRSEKLQLGVLQPPVSQQADADSEIPIGTSKVQKESNENI
SCLLTMGTSSQMEKADNVKTPRFLLFGQPILTEQQMSSVLSTHAPPQVQTERNSDWAQLK
TERITPDWKCLSESLSSTFLWNKGYHAAELGASTDHCKVFLDSEDVGRTLDLSVLGSYAE
LYKRLADMFEMERLDMVTRVLYLDATGASKQIGDEPFSDFIKTAKRLTILKKSGNSATRK
WLTDLPILNVV
Download sequence
Identical sequences K4C9N1
Sopim06g075150.0.1 Solyc06g075150.2.1 NP_001234880.2.44838 Solyc06g075150.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]