SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc07g049540.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc07g049540.1.1
Domain Number 1 Region: 14-171
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 1.81e-35
Family Pollen allergen PHL P 1 N-terminal domain 0.00042
Further Details:      
 
Domain Number 2 Region: 153-249
Classification Level Classification E-value
Superfamily PHL pollen allergen 1.26e-21
Family PHL pollen allergen 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc07g049540.1.1
Sequence length 257
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch07 gene_region:57160827-57162596 transcript_region:SL2.40ch07:57160827..57162596- go_terms:GO:0005576 functional_description:"Expansin-b5 (AHRD V1 ***- D7LRS2_ARALY); contains Interpro domain(s) IPR007112 Expansin 45, endoglucanase-like "
Sequence
MAANLSLWIITIFFCSYLVTFSSCQPSGFSLAVATFYTDAGSGGACGLENDVANSPYNSM
ITAGNQALFKQGVGCGACYQVFCNEAQNPHCSGNPITVTLTDECPGSCNDDPVHFDFSGI
AFAKLAKPGEQAELHKAGRIPIYYKRVACNYNRNILFKVDKGSNPNFFAVVSEAVDGDGD
LSLVEIQTGGKKNTWNSMNRMIGSTWSVGIDPNTQKPPFSLRLTSGTKQSVTALNVIPDG
WQPTQFYNSNVNFPCKL
Download sequence
Identical sequences K4CF56
Sopim07g049540.0.1 Solyc07g049540.1.1 XP_004243861.1.44838 Solyc07g049540.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]