SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc08g006210.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc08g006210.1.1
Domain Number 1 Region: 293-389
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-19
Family B3 DNA binding domain 0.0076
Further Details:      
 
Domain Number 2 Region: 4-97
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-19
Family B3 DNA binding domain 0.0013
Further Details:      
 
Domain Number 3 Region: 157-248
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-18
Family B3 DNA binding domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc08g006210.1.1
Sequence length 401
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch08 gene_region:907768-911493 transcript_region:SL2.40ch08:907768..911493+ go_terms:GO:0003700 functional_description:"B3 domain-containing protein Os03g0212300 (AHRD V1 *-*- Y3123_ORYSJ); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MKIPPKKPHFLKPILPGCKQQITIPIGFFKYLKGQENEYALLRRASKKWSVKVNGRRLED
GWEEFVKDHDLQLGNVLIFRHEGDMEFEVAVFDSSCCEREYEQGVHVHGGEEEEACIVEE
SSKKLKSKEKPKRKVKKSGKGFSNVKAAYKDKHLSRSHFICTIRPYCLSKYCLCIPKQFA
QENSLRNRKCEIIVRDEQRSWTFGVHTNGKNTFIGSGWHEFSRTKCLKEGDILMFEIVSN
GETPIFRFHDLRESPFLQDEVKKKDSDAERMSDEDATLETSDVTTPKSQEAADANPHFIS
TIKPYTLRFPVLYLPIAFAKSNGLLDKRELIIMDEKRRSWSMCLGQIDKYHFGIKKGWRK
FIEANGVQVGDTYKFELINNGTIPLVHFHCKYDDVGDGKGN
Download sequence
Identical sequences K4CIB0
Solyc08g006210.1.1 Solyc08g006210.1.1 Sopim08g006210.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]