SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc08g006220.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc08g006220.2.1
Domain Number 1 Region: 5-98
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-19
Family B3 DNA binding domain 0.0014
Further Details:      
 
Domain Number 2 Region: 148-239
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.08e-18
Family B3 DNA binding domain 0.0048
Further Details:      
 
Weak hits

Sequence:  Solyc08g006220.2.1
Domain Number - Region: 90-123
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 0.085
Family Phycoerythrin 545 alpha-subunits 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc08g006220.2.1
Sequence length 246
Comment genomic_reference:SL2.40ch08 gene_region:912609-915803 transcript_region:SL2.40ch08:912609..915803+ go_terms:GO:0003700 functional_description:"B3 domain-containing protein Os03g0212300 (AHRD V1 ***- Y3123_ORYSJ); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MKVASKKPRFFKPIQPGYKHCIKIPIGFLKYLKGLNHIKQAILRSRGKKWLVKVTGWRLE
EGWKKFAKENDLQLGDLLIFKHEGDMEFEVSIFDSSHCDREYAEYLQEEEGNYVDATSKK
VEKDLRHKTSDMTTPISQTPASTSADADPHFISTIRRYTFTKAILYFPMRFVKSNGLMSR
SEMILVDEKQRSWSVLLGQMEHHFGIKRGWPQFRKANGLQEGDTYKFELTNNGTIPIIHM
SKYSGN
Download sequence
Identical sequences K4CIB1
Solyc08g006220.2.1 Sopim08g006220.0.1 Solyc08g006220.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]