SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc08g008380.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc08g008380.2.1
Domain Number 1 Region: 121-260
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.37e-40
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 572-654
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000981
Family PB1 domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc08g008380.2.1
Sequence length 683
Comment genomic_reference:SL2.40ch08 gene_region:2808202-2812983 transcript_region:SL2.40ch08:2808202..2812983+ go_terms:GO:0003700,GO:0008022 functional_description:"Auxin response factor 9 (AHRD V1 **** D7R605_SOLLC); contains Interpro domain(s) IPR010525 Auxin response factor "
Sequence
MENQGSFMSNQQHQQHNFLAEGEDELCQELWRLCAGPLVDVPKNEERVYYFPQGHMEQLE
ASTNQELNQSIPLFNLQPKILCRVLHIQLLAEQDSDEVYAQIALLPEADQVEPTSPDLSL
PEPPRPKVHFFCKVLTASDTSTHGGFSILRKHANECLPPLDMTQATPAQELVAKDLHGFE
WHFKHIFRGQPRRHLLTTGWSTFVSSKRLVTGDSFVFLRSGKGEVRIGIRRLARQPSSMP
QSVISSQSMHLGVLATASHAVTTQTMFVVYYKPRTSQFIIGLNKYLEAVKHRYSVGMRFK
MKFEGEEIPEKRFTGTIVGVEDSSSQWKDSKWRSLKVQWDEPASVPRPDRVSPWDIEPFV
ASVATPLVPPMGVKNKRHRAHNEPKSSEPVPAAALAAWIPSAQFNPVIEGQSSDNPFSLH
TSQTNSTATNSTFKARVDGIWSASKVNASLNMLLDETEASKSASPRPAFPSFASSQFGKQ
NDLLLPSLDDERKCGTITSCRLFGIDLKCPSFGSVNENPPLEPANNSDGSAEGCSGNLTS
AGDSEDNSGLSRDSEDQKQEQLNPPPKEVHIKQVSSTRTRTKVQMQGVAVGRAVDLTKLN
GYDELLRELEELFDIQEELHARNKWEIVFTDDEGDMMLMGDYPWSEFCNIAKRIFICSSQ
DMKSFSAGTKSPSCLESETTAST
Download sequence
Identical sequences K4CIX2
XP_010324457.1.44838 XP_019070562.1.44838 Solyc08g008380.2.1 Solyc08g008380.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]