SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc08g029090.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc08g029090.2.1
Domain Number 1 Region: 479-579
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-20
Family B3 DNA binding domain 0.005
Further Details:      
 
Domain Number 2 Region: 3-96
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-19
Family B3 DNA binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc08g029090.2.1
Sequence length 584
Comment genomic_reference:SL2.40ch08 gene_region:22654683-22657391 transcript_region:SL2.40ch08:22654683..22657391+ go_terms:GO:0006355 functional_description:"B3 domain-containing protein At3g18960 (AHRD V1 *-*- Y3896_ARATH); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MPPQFFKIILSPHASKLNIPDEFVIKYGADLRDVVFLEVPTGAIWKVELLQNSNGTKYLN
NGWNQFKEYYSIAIGYFLLFQYNGNSHFSVCIFDLSASEIEYLSGPNEHEPPVSRPNCLA
ERHREKPDVGEDLTYATQKRKKSKRNGHSNEVVDPSTSKVTTTNQHRTVDCRYPLRSKQR
KDVKIEKGDVEEGHCNEALDPSTSKVHSKKRTAASLDASNCRYPLRSKQLKEVKVVKGDV
EDHCNKIHLVADPSATKMTTTVRHHEKKTSASFDTSHCRYPLRNKQLKEVKPGKTNAEKD
LLYVAQKAKRKKANNVKLEKGDAEERSKVGDPSASTTTNQHNEKKTTTSLDASHCRCPLR
SKQHKEVKLEQWEAGGNMHNKTPVADSPYCRSQNPSLPASSPSCQPVRVKLEKPDNLFCA
AEKVKGRETNNVKLDTGDLEGNLVAASYKGKYSTASEMTVLGKKKMLPSETQNRDMYFNP
HFTVSMLPAYVSRNFQLEIPADFFKKRVNEEETIVNLRVSNGRSWRAKLFDIQSNCPKME
SSGWRDFVIDNNLKEHDTCVFELNDGIEPMLLDVTIFRATTPVS
Download sequence
Identical sequences K4CJX2
Solyc08g029090.2.1 Solyc08g029090.2.1 XP_004244892.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]