SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc09g007810.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc09g007810.2.1
Domain Number 1 Region: 116-223
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-29
Family B3 DNA binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc09g007810.2.1
Sequence length 694
Comment genomic_reference:SL2.40ch09 gene_region:1332643-1335760 transcript_region:SL2.40ch09:1332643..1335760- go_terms:GO:0003700,GO:0035198 functional_description:"Auxin response factor 3 (AHRD V1 **** A4L9W4_GOSHI); contains Interpro domain(s) IPR010525 Auxin response factor "
Sequence
MITFMDPKEKVKEVEKCLDSQLWHACAGSMVQMPSISSKVFYFPQGHSEHASGNVDFRSS
IRIPSYIPCKVSAIKYMADPETDEVFAKIRLIPVGRNEVEFDDDGVVGMNGSDNQDKPSS
FAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSADPPVQTILAKDVHGETWKFRHIYRGT
PRRHLLTTGWSTFVNHKKLVAGDSIVFLRAENGDLCVGIRRAKRGIGGGPETSSGWNPAG
GNCMVPYGGFSSFLREDENKLMRNGNGNNGGNLMNKGKVKAESVIEAANLAASGQPFEVI
YYPRASTPEFCVKSSLVKSALQIRWCSGMRFKMPFETEDSSRISWFMGTISSVQVSDPIR
WPDSPWRLLQVTWDEPDLLQNVKRVSPWLVELVSNMPTIHLSPFSPPRKKLRLPQHPDFP
LDGHLPMPAFSGNHLLGPNSPFGCLPDNTPAGMQGARHAQYGLSLSDLHFNKLHSSLFPV
GFPPLDQAAAAPRRPLNSPMISKPCNNENISCLLTMGNSAHSTKKSDIGKAPQLVLFGQP
ILTEQQISLSCSGDTVSTVRTGNSSSDGNADKIGNVSDGSGSALNQRGLTERSPCDTFQS
DPNTEIGHCKVFMESEDVGRTLDLSLLGSYEELCRKLANMFGIDNSEMLNHVLYRDTTGS
VKQLGDEPFSDFMKTARRLTILTDSSSDNVGIRE
Download sequence
Identical sequences K4CQH0
XP_004246657.1.44838 Sopim09g007810.0.1 Solyc09g007810.2.1 Solyc09g007810.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]