SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc10g086250.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc10g086250.1.1
Domain Number 1 Region: 10-107
Classification Level Classification E-value
Superfamily Homeodomain-like 2.07e-28
Family Myb/SANT domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc10g086250.1.1
Sequence length 275
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch10 gene_region:64457942-64459499 transcript_region:SL2.40ch10:64457942..64459499- go_terms:GO:0003677,GO:0045449 functional_description:"MYB transcription factor (AHRD V1 **-- A9YY82_SOLTU); contains Interpro domain(s) IPR015495 Myb transcription factor "
Sequence
MNTPMCASLGVRKGSWTEQEDSLLRDCIQKYGEGKWHLVPARAGLNRCRKSCRLRWLNYL
RPHIKRGDFAPDEVDLILRLHKLLGNRWSLIAGRLPGRTANDVKNYWNTHFHKKLSIIAP
HLHPHSRPRSHPRLQIKHKSIAVTKNEIIRPQPRNFSNVKKNDSHWCNNKSMITNTLDKD
DKRCNEIVVNICEKPIGENTSSIDDGVEWWTNLLENCIEIEEETANTNFGKTPTMLLHEE
ISPPLVNGEDNSMQQGPTNNWDDFSTDIDLWNLLN
Download sequence
Identical sequences K4D457
NP_001265992.1.44838 Solyc10g086250.1.1 Sopim10g086250.0.1 Solyc10g086250.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]