SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc12g006350.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc12g006350.1.1
Domain Number 1 Region: 113-186
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-28
Family B3 DNA binding domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc12g006350.1.1
Sequence length 186
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch12 gene_region:871641-873422 transcript_region:SL2.40ch12:871641..873422+ go_terms:GO:0003700 functional_description:"Auxin response factor 6 (AHRD V1 **** C7FFK5_SOLLC); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MKVSTSGFNSQPEEGEKKSLNSELWHACAGPLVSLPHVGTRVVYFPQGHSEQVAASTNKE
INGHIPSYPGLPPQLICQLHNVTMDADVETDEVYAQMTLQPLTPQEQKDVCLLPAELGTL
SKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPVQELIGKDLHGNEWKF
RHIFRG
Download sequence
Identical sequences K4DBH2
XP_019067187.1.44838 Solyc12g006350.1.1 Sopim12g006350.0.1 Solyc12g006350.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]