SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc00g286020.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc00g286020.1.1
Domain Number 1 Region: 49-139
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 1.36e-19
Family ParB-like nuclease domain 0.0049
Further Details:      
 
Weak hits

Sequence:  Solyc00g286020.1.1
Domain Number - Region: 131-191
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.000523
Family KorB DNA-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc00g286020.1.1
Sequence length 312
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch00 gene_region:20941227-20942165 transcript_region:SL2.40ch00:20941227..20942165+ go_terms:GO:0003677 functional_description:"Plasmid partitioning protein RepB (AHRD V1 **-- B8ISQ1_METNO); contains Interpro domain(s) IPR017819 Plasmid partitioning protein, RepB "
Sequence
MPLLGVTRKERDPATKLTANIGNALREQNDRLSRAEEIERRLAEGQAVIELDASSIEPSF
VQDRMRGDIDGLLTSIREQGQQVPILVRPHPSQPGRYQVAFGHRRLRAVSELGLPVRAVV
RELTDEQVVVAQGQENNEREDLTFIEKARFAHRLNRQFSREIVIAAMSIDKSNLSKMLLL
VDALPSELTDAIGAAPGVGRPSWQQLAELIEKVSSPADVAKYAMSEEVQALPSAERFKAV
IASLKPSRVARGLPEVMATPDGTRIAQVTQSKAKLEITIDRKATPDFATFVLDHVPALYQ
AYHAENQRKRGE
Download sequence
Identical sequences P05683
Solyc00g286020.1.1 Sopim00g286020.0.1 Solyc00g286020.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]