SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc01g106320.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g106320.2.1
Domain Number 1 Region: 56-148
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.69e-20
Family PB1 domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc01g106320.2.1
Sequence length 493
Comment genomic_reference:SL2.40ch01 gene_region:86005942-86007808 transcript_region:SL2.40ch01:86005942..86007808- functional_description:"Octicosapeptide/Phox/Bem1p domain-containing protein (AHRD V1 *--- D7MPG4_ARALY); contains Interpro domain(s) IPR000270 Octicosapeptide/Phox/Bem1p "
Sequence
MENYSYTSYPESGDSSPRSREIDFENTAAWEDPNQIPNYKVKFMCSYGGKIHPRPHDNQL
AYIGGETKILSVERNTKFPLLISKLAAICDTDTVSFKYQLPGEDLDALISVTNDDDLEHM
MHEYDRLYRASPKPARLRLFLFPANTPATVGSGVSQSRSFGSEDSKSEKDRFVDALNSGP
IQASPAAGAVAQQVGNADFLFGSEKGMVPPHVKLRDPNSEQVVKEPEMPVHGVDDRMMGT
DPIQKHIQDLQRLHLEEQQNLYRRKSDDNLTAAFPGGDYYVQRGPEKIASPTVPGTVPAQ
VGYWQEKQVPGGVLPASSLGMEQPVYMIHQAPAGAYQPHQHQHQHPQFVRPMAGPPGQGY
YAVQRMPQEPYRDQPVYNVMPSLPQAVPTVAAAPPTLQSQVPPKVAGYSEGYGMVRPATT
MGVGVADAGGYTQMAYDGGVGRQMYYPPQGGVIAPPQQQPQYHAMPPQAVVGSDMRPQEA
AKVVPVKPTQTSV
Download sequence
Identical sequences K4B2K0
Solyc01g106320.2.1 Solyc01g106320.2.1 Sopim01g106320.0.1 XP_004230573.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]