SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc02g071330.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g071330.2.1
Domain Number 1 Region: 10-218
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.07e-25
Family BAR domain 0.042
Further Details:      
 
Domain Number 2 Region: 229-306
Classification Level Classification E-value
Superfamily SH3-domain 8.27e-19
Family SH3-domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc02g071330.2.1
Sequence length 317
Comment genomic_reference:SL2.40ch02 gene_region:35391296-35396537 transcript_region:SL2.40ch02:35391296..35396537+ go_terms:GO:0030276 functional_description:"SH3 domain-containing guanine exchange factor (AHRD V1 *--- SGEF_HUMAN); contains Interpro domain(s) IPR001452 Src homology-3 domain "
Sequence
MVIDEMEMQLHHQLDKLYKSTREKRDFQKEIVKAAETFTAIGYKHIEPGTKLSEDCCKYG
VENPNDEVLAKAASIYGDARKHAEKEVEDLNKLFFSQVLEPLRAMVAGSPLEDARHLAQR
YSKMRQEAEIQATEVSRRQARVREAPIPENVAKLHSAETKMQELKANMTVLGKEAAAALA
AVESQQERLTFQRLVAMVEAEKLYHERVAVILGNIEAEIVSEKQRKEAAPPVATLPVNPP
AQIPEKTKYFLAEAIHSFEAESEKELSLSVGDYVVVRKVTQSGWSEGECQGRAGWFPSEY
VEKRQRVPTSNGATEAY
Download sequence
Identical sequences K4B8A9
Sopim02g071330.0.1 Solyc02g071330.2.1 Solyc02g071330.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]