SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc02g087700.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g087700.2.1
Domain Number 1 Region: 22-68
Classification Level Classification E-value
Superfamily PH domain-like 0.0000799
Family SSRP1-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc02g087700.2.1
Sequence length 72
Comment genomic_reference:SL2.40ch02 gene_region:44605702-44606313 transcript_region:SL2.40ch02:44605702..44606313- go_terms:GO:0005634 functional_description:"FACT complex subunit SSRP1 (AHRD V1 ***- SSRP1_CATRO); contains Interpro domain(s) IPR000969 Structure-specific recognition protein "
Sequence
MPIDWSGSCWFDGIAILTPRLSDWQCARPYAVGYYNVELHLSFLHLHGQANDFKIQYNSL
VRVFCCPRLFPV
Download sequence
Identical sequences K4BBS6
Solyc02g087700.2.1 Solyc02g087700.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]