SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc03g114060.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g114060.2.1
Domain Number 1 Region: 320-427
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 6.02e-18
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0028
Further Details:      
 
Weak hits

Sequence:  Solyc03g114060.2.1
Domain Number - Region: 47-175
Classification Level Classification E-value
Superfamily BAH domain 0.00327
Family BAH domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc03g114060.2.1
Sequence length 1602
Comment genomic_reference:SL2.40ch03 gene_region:58154643-58161458 transcript_region:SL2.40ch03:58154643..58161458+ go_terms:GO:0005634,GO:0003677 functional_description:"Os02g0742100 protein (Fragment) (AHRD V1 *-*- Q0DXN7_ORYSJ); contains Interpro domain(s) IPR001025 Bromo adjacent region "
Sequence
MHGKGQRGSELCRRLIGGQHMPVTTTTTVAVGDSSVVSTITADSFCKDGRKVSVGDCALF
KPSHDSPPFIGIIRRLKLSEDNNLQLGVNWLYRPAELKLCKGILPEAAPNEIFYSFHRDE
TPAASLLHPCKVAFLSKGAELPTGISSFICRRVYDISNECLWWLTDQDYIKELQEEVGQL
LNKTRVEMHATVQPGGRSPKPMNGSMSTSQLKPGSDNVQSSVTSFPTHVKGKKRERGDQG
PESIKRERSIKTEDIDSSQIKAESILKSEISKITDKGGLVNSEGVEKLVHLMQPDRNEKK
MDLISRSMLASVVAATENFDCLTRFVQLRGLPVLDEWLQDVHKGRIGESSNTKDGDKSIE
EFLFVLLRALDKLPVNLQALQMCHIGRSVNHLRQHKNTEIQRKARSLVDTWKKRVEAEMN
IIDAKSGSNQAATWPSKSRLPEASHSISKNPGGSNDVTKSAVAQLSASRMASIKTSQGET
TVKSASLSPGSTKPASSPASGKEGQHRVSVGGSCDVPSAREDKSSSSSQSHNHSQSISGK
EDGRSSTAVSMNSIKISTGGSRHRKSNNGYPGSSISGSQKETPAGRSSHRNPTSEKLPQS
AVSGEKIMDVPVLEGSGHKLKVKMSSRGRSPAQSASGGSYEDPTNMSSRASSPVLSEKSD
QFDRTLKEKTDADRSNLEANAESWQSNDFKDILTGSDDGDGSPAAVTEEERSKIVDDSRR
SAEVRAACTSGTEAKSGKLHEASYSPMNALIESCVKYSESNVPMLLGDAIGMNLLASVAA
EEMSKSNMVSPSVSSHRNTPAAEEACTGDDAKSKSPPGDITAGDRKNDDGDGNGEELIIA
SASWSEDKLLSSMGAAIELPGDRKASVSPSQETMAGGCKQFNSPCFDSQTAGEKLEITEK
SGEVEKYASSPRTVSEKAIDGEASKQFHEETVVSREVKVEGPLDAKLGGDGASVLGDKVA
STVASLEDQKPSVEVCTSKFESENKNGMNRVLNIASAETKPSSVVVNSEKLEGSDKEERL
ANIEASVEDKARVGTDIVTRNQKGEASVERKNVVPVQNSGLLLNQKDRSGFSNAEVQKHG
ESRELNFSAGEADKKKDCGSTNAKISFVSTAAPESASKVKFDLNEGFFSDEGKYGDPINL
TGPGCLSNVHIMNPLPFAVSSVSCSLPASITVAAAAKGPFVPPEELLRVKGEFGWKGSAA
TSAFRPAEPRKSLDMPLSSATISRAEASTGKHSRPQLDIDLNVPDERTFDDINGQDSALE
LISPLGHSASRASLKNDVIDSPAVRCSGGLDLDLNRLDEPGDAGQCSVSSSCRLDGAVFP
SKASTVGLPTGDVRRDFDLNNGPSVDESNAEQSLFHDNYQGSMRSQLPASNLRLNNPEMG
NLSSWFTPGSTYSTVTLPSILPDRVEQTPFPIVTPGAQRILGPAGSPFTPDVYRSSVLSS
SPAVPFQSSPFQYPVFPFGTSFALPSASFSVGSTSFVDPSSGGRIYTPSVNSPLLGPVGS
VSSQYPRPYVVGLPDSNSNGTMDHNRKWGRQGLDLNAGPGVVDMEGREESVSLTSRQLSV
AGSQALAEEHGRMYAVSGGVLKRKEPEGGWDSESFRFKQSWH
Download sequence
Identical sequences K4BKQ8
Solyc03g114060.2.1 Solyc03g114060.2.1 XP_010318921.1.44838 XP_010318922.1.44838 XP_010318923.1.44838 Sopim03g114060.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]