SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc03g118550.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g118550.2.1
Domain Number 1 Region: 211-384
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.05e-30
Family Thioltransferase 0.00039
Further Details:      
 
Domain Number 2 Region: 93-205
Classification Level Classification E-value
Superfamily TPR-like 1.01e-22
Family Tetratricopeptide repeat (TPR) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc03g118550.2.1
Sequence length 386
Comment genomic_reference:SL2.40ch03 gene_region:61487486-61491647 transcript_region:SL2.40ch03:61487486..61491647+ go_terms:GO:0030544 functional_description:"Thioredoxin h2 (AHRD V1 *-*- A1BLP7_MEDTR); contains Interpro domain(s) IPR013766 Thioredoxin domain "
Sequence
MDTEKLEDLKHFVELCKENPSILQNPSLTFFKTFLESLGAQLPPSVKSEQCGEEHHDELD
EDIVESDVELDNTDIVEPDNDPPQQMGDSTTEVTDENRDAAQISKAKALDAISEGKLDEA
INHLTEAILLNPTSAILYATRANVFIKLKKPNAAIRDADAALKVNPDSAKGYKVRGMARA
MLGLWKEAASDLRVASMIDFDEEIAEILKKVEPNAHKIEEHCRKYQRLREDKRLRKIERD
SQQRQAEPKAANEKSKKKEQQSEHEASDPDSASDLNYGKIVGIHSVSELETKLNAVSKGS
RLAILYFTATWCGPCRFISPFYTSLPEKYPKVAFLKADIDEARDVASRWNVSSVPAFFFI
KNGKEVDKVVGADKNSLEKKIAQHAG
Download sequence
Identical sequences K4BM06
Sopim03g118550.0.1 Solyc03g118550.2.1 Solyc03g118550.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]