SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc03g120280.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g120280.1.1
Domain Number 1 Region: 311-434
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-28
Family Ran-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc03g120280.1.1
Sequence length 449
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch03 gene_region:62781048-62782397 transcript_region:SL2.40ch03:62781048..62782397+ go_terms:GO:0005643,GO:0046907 functional_description:"RAN binding protein 3 (AHRD V1 *-*- Q6DJQ7_XENTR); contains Interpro domain(s) IPR000156 Ran Binding Protein 1 "
Sequence
MGDAENSLQPSKKRAAIKELSRDNPGLDDDENEAELETGSFKKASEEVMASRRIVKVRRS
QTTSSTATPSANPFAAIRLVPPTESSIPSTVITSEVESGITSSGKPEDKNDIGEATRKET
NDVCKEELKESDQISKPSEGNVDESNVVKEKVETPNEADKPESAEEKVADDEKVQAETKE
GTVVEKSENDSKKDVEVEKTKNEEQNDAGGEKSEKGAETASFSSFQQLSSGQNAFTGFSG
TGFSSTTFSFGGISKEGSSLGFGSESGAGSLFGAKSDQSPFGLNLPTNGSTSLFGNSGSS
LVNKSEGTGFPSKEEVTVETGEENEKPVFAADSVLFEYLNGGWKERGKGELKVNVSTTGE
GKGRLVMRTKGNYRLILNASLFPEMKLANMDKRGVTFACLNSAADGKGLSTIALKFKDAS
IVEDFRAAVVEHKGTTTGSLKTPENSPKA
Download sequence
Identical sequences K4BMH7
Sopim03g120280.0.1 Solyc03g120280.1.1 Solyc03g120280.1.1 XP_004235706.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]