SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc04g007000.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc04g007000.1.1
Domain Number 1 Region: 201-296
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.83e-29
Family B3 DNA binding domain 0.0000149
Further Details:      
 
Domain Number 2 Region: 65-121
Classification Level Classification E-value
Superfamily DNA-binding domain 1.57e-17
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc04g007000.1.1
Sequence length 372
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch04 gene_region:728928-730046 transcript_region:SL2.40ch04:728928..730046+ go_terms:GO:0003677,GO:0016564 functional_description:"Ethylene-responsive transcription factor 4 (AHRD V1 *-** ERF78_ARATH); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MEVSCIDQEISTTSDSPSTISPAGSPRQMGSGVSVVTDADSTNGVEAESKNTTITNNNNN
KLPSSKFKGVVPQPNGRWGAQIYEKHQRIWLGTFNGEEEAARAYDIAAQRFRGRDAVTNF
KPLFDFQTEEIEISFLNSRSKVEIVEMLRKHTYNDELQHAKKVYNNNTFEMNGRSTCHTN
TNIATFSLDTNEKVANIASELLFEKVVTPSDVGKLNRLVIPKQHAERYFPLVAKVNKNDN
TSKGVLLNFEDMNGKMWRFRYSYWNSSQSYVLTKGWSRYVKEKKLKAGDIVSFKRCSGVE
IEDKLLIDSKNRIIRGEQVKMVRLFGVNICKVQDVSNNVVVEKNMSVGKRMREMELLAFE
CSKKQRVIIDAL
Download sequence
Identical sequences E1U2K4
Solyc04g007000.1.1 Solyc04g007000.1.1 XP_004236999.1.44838 Sopim04g007000.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]