SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc04g076850.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc04g076850.2.1
Domain Number 1 Region: 227-330
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.4e-21
Family PB1 domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc04g076850.2.1
Sequence length 349
Comment genomic_reference:SL2.40ch04 gene_region:59354651-59358834 transcript_region:SL2.40ch04:59354651..59358834+ go_terms:GO:0003700 functional_description:"Auxin responsive protein (AHRD V1 *-*- D9IQE6_CATRO); contains Interpro domain(s) IPR003311 AUX/IAA protein "
Sequence
MSPPLLGVGEEEGQSNVTLLASSTSLGSICIKGSALKERNYMGLSDCSSVDSCNISTSSE
DNNGCGLNLKATELRLGLPGSQSPERGEETCPVSSTKVDEKLLFPLHPSKDTAFSVSQKT
VVSGNKRGFSDAMDGFSEGKFLSNSGVKAGDTKETSRVQPPKMKDANTQSTVPERPSAVN
DASNRAGSGAPATKAQVVGWPPIRSFRKNTLASASKNNEEVDGKAGSPALFIKVSMDGAP
YLRKVDLRTCSAYQELSSALEKMFSCFTIGQYGSHGAPGKDMLSESKLKDLLHGSEYVLT
YEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGLAPRAMEKCRSRN
Download sequence
Identical sequences K4BUC3
Sopim04g076850.0.1 Solyc04g076850.2.1 NP_001265888.2.44838 Solyc04g076850.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]