SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc06g008580.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g008580.2.1
Domain Number 1 Region: 87-180
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.42e-21
Family PB1 domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc06g008580.2.1
Sequence length 190
Comment genomic_reference:SL2.40ch06 gene_region:2489747-2491131 transcript_region:SL2.40ch06:2489747..2491131- go_terms:GO:0003700 functional_description:"Auxin responsive protein (AHRD V1 ***- D9IQE6_CATRO); contains Interpro domain(s) IPR003311 AUX/IAA protein "
Sequence
MATIYENNDLATELRLGLPGTTDKSKTRVSSTSTTNKRSLSEMDSSSDIINQNDQQDSSP
PPKVQIVGWPPVRSCRKNVGVQAKNSIDISIGMYVKVSMDGAPYLRKIDLRVYKNYQELL
KALEYMFKHPIGVFLEKEGYTTSGSDYVLTYEDKDGDWMLVGDVPLDMFISSCKRLRIMK
ESDAKGLGCL
Download sequence
Identical sequences G9HPW8
Solyc06g008580.2.1 Solyc06g008580.2.1 NP_001266082.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]