SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc06g066020.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g066020.2.1
Domain Number 1 Region: 133-222
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000000203
Family PB1 domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc06g066020.2.1
Sequence length 242
Comment genomic_reference:SL2.40ch06 gene_region:37766161-37768507 transcript_region:SL2.40ch06:37766161..37768507+ go_terms:GO:0003700 functional_description:"Auxin response factor 9 (AHRD V1 *-** ARFI_ORYSJ); contains Interpro domain(s) IPR003311 AUX/IAA protein "
Sequence
MELELGLGLALPNSNPIKYSYLNDNNINIDTFDDNFSEMKKIDNDDYGSNKVEGKTLSLL
IWNGQPNEEEEEDNDDGHQKRRYFEACYDQEFKEENGVVGWPPIKSWRKKLIHGINHEVG
WNKNNNNNNNNNHRHNIGIRNSMYVKVKMEGVAIGRKIDLMLYNSYQILTNTLLQMFNKS
HESCDENDGRFTLLYQDKEGDWMLAGDVPWETFMETVQRIQILSNWKSGGSTRKSSHIPQ
QF
Download sequence
Identical sequences G9HPX6
Sopim06g066020.0.1 Solyc06g066020.2.1 Solyc06g066020.2.1 NP_001266100.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]