SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc06g066740.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g066740.1.1
Domain Number 1 Region: 314-438
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-32
Family Ran-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc06g066740.1.1
Sequence length 450
Comment evidence_code:10F1H1E1IEG genomic_reference:SL2.40ch06 gene_region:38323238-38324590 transcript_region:SL2.40ch06:38323238..38324590+ go_terms:GO:0005643,GO:0046907 functional_description:"Ran binding protein 3 (AHRD V1 *-*- Q6IP83_XENLA); contains Interpro domain(s) IPR000156 Ran Binding Protein 1 "
Sequence
MGDADSLQPSKKRAAVKELSRDNPGLDDDNESSEQENGTFKRASDEVMANRRIVKVRKTA
STTTTPSSNPFAAIQLVLPANTSTPAVTTTEAGNGTTTTKKTEDSNDQSEGIKKEETDVS
KEANHEKESDKNSKLPKSKSESTADANVDKEKVDNPNEPNKPESTEKKAVGSENIKDDTE
TVTVVEKSADDIEVEGNKTENEMKKHVGGGKNDKDAETASFGSFQQLSSSQNAFTGLAGT
GFANTTFSFGANSKEGSPLGFGSESGAGSGSGSLFGAKSDQSIFGVSLPTNGNASLFGYS
GSSSVKKSEGTGFPSMQEVPIVTGEEHEKAIFTADSVLFEYLNGGWKERGKGELKLNISS
GTGKARLVMRTRGNYRLILNANLYPEMKLASMDKKGVTFACMNSADDGKDGLSTIALKFK
DASIIEEFRAAVMEHKNKIEVSLKTPPNSP
Download sequence
Identical sequences K4C7U8
Solyc06g066740.1.1 Solyc06g066740.1.1 XP_004241727.1.44838 Sopim06g066740.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]