SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc06g071350.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g071350.2.1
Domain Number 1 Region: 294-401
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 4.45e-18
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0026
Further Details:      
 
Weak hits

Sequence:  Solyc06g071350.2.1
Domain Number - Region: 28-148
Classification Level Classification E-value
Superfamily BAH domain 0.00837
Family BAH domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc06g071350.2.1
Sequence length 1608
Comment genomic_reference:SL2.40ch06 gene_region:40302177-40308190 transcript_region:SL2.40ch06:40302177..40308190+ go_terms:GO:0005634,GO:0003677 functional_description:"Os02g0742100 protein (Fragment) (AHRD V1 *-*- Q0DXN7_ORYSJ); contains Interpro domain(s) IPR017923 TFIIS N-terminal IPR001025 Bromo adjacent region "
Sequence
MPATTTRRTVDVGGSSIVNTVTADSFCKDGRKIRVGDCALFKPPHDSPPFIGIIRRLRLG
KDNNLQLGLNWLYRPAELKLSKGILLDTTPNEIFYSFHRDETPAASLLHPCKVAFLPKGA
ELPTGISSFVCRRVYDISNKCLRWLTDRDYNNEQQKEVDQLLYKTQVEMHATVQPGGRSP
KPMNGSISSSQLKTGSDNIQSSVASFPSQVKGKKRERGEQGSESIKRERSVKSDDSESVL
KSEISKITEEGGLVDCEGAAKLVQLMQPDRVDRKMDLTSRSMLASVVAATDKFDCLARFV
QLKGLPVLDGWLQDVHRGRIVEVSNSKDGDISIEEFLLVLLRALDRLPVNLQALQMCNIG
KSVNHLRQHKNMEIQRKARSLVDTWKKRVEAEMNMIDSKSGSNQAVTWPSKARLPEASHS
GEKNAGGSTDATRSSVTQFSASKTTSIKPTPVETNMKSACSSPGPIKQASPPSSGKVGQP
RISAFGSSDVPLAREDKSSSSSQSHNHSQSLSGKEDARSSTAVSMSSIKISSGGSRHRKS
INGGPGPSVSAGQKEGSTNRSSSLHRNPTTEKSLQSALSGEKTVDVPAVEGSCHKLIVKI
PNKGRSPARSVSGGSCEDPSIMSSRASSPVLSEKNDQLDRNSKEKKDAYRSDVTINVNTE
SWQSNVLKDVLTGSDEGDGSPVAVLEEERRKTAGEGRKSAEVAKPGSSSSGTELKSGKLH
EASFSSMNALIESCAKYSEANASMSLSDAVGMNLLASVATEEMSKSGRVSPFVSPQGDSP
SGGETCTGDELKPKTSPVDSSSGNHSGRNDGDANGDKEKQFVVANTSWSEGKVHANRSAM
TDFNRERRPSSSPSEETTTGECFNSSCTDSQMAGNLKSGVNEKLVEMAKSAAAPCNVFEK
ASDGEQSRQFHEEKVISTKTLDNVLDGESGGHGSSIGEDKVTNGLVSIEGLKRPVGISAF
KYEGDDKNDVSRVLGVASTEVKPPSVVVKSEATERGDKEELQQTGSSRDTIAGKGGHSDE
MDANSVLKSEQPNSDKKTVDTSVIEDKAASECNLAIRNLTKDEPKAEEMTKHDSGSGLLT
KKETPGFSNAEVENLESRESKYSGVEADRPKECVSIKGENSSSSAAAAPDSASKMKFDLN
EGFISDEGKYGESINSTGPGCLSNVQIMSPSTFAVSSVSSSLPASITVAAAAKGPFVPPE
DLLRVKGEFGWKGSAATSAFRPAEPRKPPDMHSNSMTISVTEASSSKHGRPPLDIDLNVA
DERVLEDINSQDCALAIGSAVDHITNLVSSKNKCSGPLRSFGGLDLDLNRVDEPNDVGQC
SLSSSHRLEGAVFPARASSSSILPTAEVRRDFDLNNGPGVDDSCAEQPLFHQSHQGNMRS
QLNASSLRMNNPEMGNLSSWFAPGNSYSTMTIPSMLPDRGEQPPFPIIPPGAPRMLGPSA
AGSPYTPDVFRGSVLSSSPAMPFPAAPFQYPVFPFGTTFPLPSGTYAVGSTSYIDSSSGG
RLFTPPINSQLLGAVAPQYPRPYMVSLPDANSNGATDHNRKRSRQGLDLNAGPGAVDLEG
KEESVSLVTRQLDEHGRMYPVAGGLLKRKEPEGGWDSESYRFKQSPWQ
Download sequence
Identical sequences Q56R07
Sopim06g071350.0.1 Solyc06g071350.2.1 Solyc06g071350.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]