SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc08g078970.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc08g078970.1.1
Domain Number 1 Region: 132-164
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000795
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc08g078970.1.1
Sequence length 201
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch08 gene_region:59792453-59794025 transcript_region:SL2.40ch08:59792453..59794025- functional_description:"Pleckstrin homology domain-containing family A member 3 (AHRD V1 *-*- PKHA3_MOUSE); contains Interpro domain(s) IPR011993 Pleckstrin homology-type "
Sequence
MAKKKKKFNKWFKKIGKIQQLENIWDKTDDYKVAFKNPLLNFFISPPSILIFPFLRSPRR
RPPPCNAAATSQILFSASMMRVREMHPLCCITLETPEIGDQSPEPTLLRTGSAVVYSGSD
INAGGSDVGGVAGILYKWTNYHKGWRSRWFTLRNGILSYSKNRRPDHLDGDDIKLIGKLP
DSNPSRRKHGKSVGIVHLKLS
Download sequence
Identical sequences K4CNQ6
Solyc08g078970.1.1 Solyc08g078970.1.1 Sopim08g078970.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]