SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc08g082420.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc08g082420.2.1
Domain Number 1 Region: 60-172
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000474
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Weak hits

Sequence:  Solyc08g082420.2.1
Domain Number - Region: 23-62
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0471
Family Mitotic arrest deficient-like 1, Mad1 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc08g082420.2.1
Sequence length 189
Comment genomic_reference:SL2.40ch08 gene_region:62399322-62402936 transcript_region:SL2.40ch08:62399322..62402936+ functional_description:"Unknown Protein (AHRD V1); contains Interpro domain(s) IPR001849 Pleckstrin homology "
Sequence
MLNMFSPRKLPWISGTDDQKKVVLTAVEVESLRSEIAALEEREAHLKAQLEHIDEILQSA
RMSGYLYLRTRWEALPGEPLPIDDDTEVDDWLPKFLVLQGSGIFLYSSSIDLSPQDSTLL
SDVVEVGAMPCLTRDNGDTRYCFFISTRHGLRYECSSASKIQVDSWLASLPNHSDLQSNC
TAPDELTNT
Download sequence
Identical sequences K4CPN8
Solyc08g082420.2.1 Solyc08g082420.2.1 Sopim08g082420.0.1 XP_010325353.1.44838 XP_010325354.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]