SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc09g074720.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc09g074720.1.1
Domain Number 1 Region: 41-129
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.000034
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc09g074720.1.1
Sequence length 239
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch09 gene_region:62040000-62042243 transcript_region:SL2.40ch09:62040000..62042243+ functional_description:"Luminidependens (Fragment) (AHRD V1 *-*- B2XBF9_CAPBU)"
Sequence
MDERDRHFVDNILTLMCKEETFSGRVKLMDWILEVQNPSVLYWFLTKGGVMILSAWLSEA
AGEEQTSVLHLILKVLCHLPLHKAFPGHMSAILQNVNSLRFYRTPDISDRARVLLERWSN
IFAKSQAMTKHNGVKSASDMHDEMLLQQSISEVVGDEIWNSKIEDVEEAHANLCGTSENS
RKLDSPQPVKLFMASSDDSNKRLKGASKSSANGTTKRKNNSKEPRKTSSTCNSRPPTLS
Download sequence
Identical sequences K4CV49
Sopim09g074720.0.1 Solyc09g074720.1.1 Solyc09g074720.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]