SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc10g078350.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc10g078350.1.1
Domain Number 1 Region: 141-227
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 7.32e-16
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc10g078350.1.1
Sequence length 409
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch10 gene_region:59506248-59508620 transcript_region:SL2.40ch10:59506248..59508620+ go_terms:GO:0005634 functional_description:"Os11g0166800 protein (Fragment) (AHRD V1 *-*- Q0IUD4_ORYSJ); contains Interpro domain(s) IPR010990 Transcription elongation factor, TFIIS/elongin A/CRSP70, N-terminal "
Sequence
MKKKNKELRQWRAYFRSSTLDIFYIIESAIRVAAIDYPQEFKLRRDGINELLFSFGDLDS
DEVENVVDVEGDKGKRKCKNELVRGLNDCDVEKRKNDSNVEVEALSDEIEEESRVVNQAL
PIKKSYAEVEALSDEIEEESRVVEEALSIKKIIDNSQNESDSNVYKSLKRLQTMGLSVEI
LQKTEIGKSVSTLRWHNSKNIRCLVRKMVKEWIEMVQEWVDARAALTERKSESTKAFVVD
EEEGGLPAPPLEDLPFLFSQTTSKIELSQIFDGMDDDGNVIISVDQKDEQEKKRTSLVKP
NKPPGVNPGRGRPTKRALEQKLNNDHEMKLQEKFDKRKTQTRPVHTQQNKLKCLDEDAER
LNLEATKRKLHECYQQVENAKRHRTVQVMSLKDIPQQGRGIRKPHNRRQ
Download sequence
Identical sequences K4D277
Sopim10g078350.0.1 XP_004249724.1.44838 Solyc10g078350.1.1 Solyc10g078350.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]