SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc10g080480.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc10g080480.1.1
Domain Number 1 Region: 156-233
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 2 Region: 254-285
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000144
Family CCCH zinc finger 0.0018
Further Details:      
 
Domain Number 3 Region: 94-126
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000641
Family CCCH zinc finger 0.0022
Further Details:      
 
Domain Number 4 Region: 35-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000068
Family CCCH zinc finger 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc10g080480.1.1
Sequence length 289
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch10 gene_region:61060405-61063905 transcript_region:SL2.40ch10:61060405..61063905+ go_terms:GO:0003723,GO:0008270 functional_description:"Zinc finger CCCH domain-containing protein 14 (AHRD V1 ***- C3H14_ORYSJ); contains Interpro domain(s) IPR018111 K Homology, type 1, subgroup "
Sequence
MDYRKRTRNDVGANVNGGVKKYKPEVDSISGGVGSKSKPCTKFFSTAGCPFGESCHFLHY
VPGGYSAATQMMKLTPAPSLRNAAAPPYSNGNAPSLKTKLCNRFSTAEGCKFGDKCNYAH
GEWELGKPTIPSQEDPRAMGFGSMPGRFGGGRVESAASFGTSATAKISVDASLAGAIIGK
GGVNSKQICRQTGAKLAIRDHETDANLRNIELEGTFEQISQASAMVRELINSLGPVGGGG
RTHGNSGGAAPPMNNLKTKLCENFAKGSCTFGDRCHFAHGAAELRKTGE
Download sequence
Identical sequences K4D2T8
Solyc10g080480.1.1 Solyc10g080480.1.1 Sopim10g080480.0.1 XP_004249283.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]