SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc10g080930.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc10g080930.1.1
Domain Number 1 Region: 131-220
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 5.23e-20
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc10g080930.1.1
Sequence length 455
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch10 gene_region:61435700-61439911 transcript_region:SL2.40ch10:61435700..61439911- go_terms:GO:0005634 functional_description:"Transcription elongation factor A protein 2 (AHRD V1 *--- TCEA2_HUMAN); contains Interpro domain(s) IPR010990 Transcription elongation factor, TFIIS/elongin A/CRSP70, N-terminal "
Sequence
MAKSSGTLDKWRDYFRTANSDIFDIIEYAVMVAAVDCPKEFKMRRDRIAEMLFTCKVTMC
FGCEKVDLAVPIAGNDDEGKIKSKDEFGGSKESKVNSRIDHHDVEMNVNQVSNYSYGEAE
ALTEEMEEETQTFGEVMRIKDVIDNNQAESAELFECLRRLQLMALSVETLKATEIGKSVN
SLRKHNSKDVRHLSRTLIEDWKVLVDEWVNATAAFAGNESTPESMKASVVDQDEEGLPSP
PLDDLAFFSAQTTSIELSQFFDGMDDDGNPRNSGGFNVNRGNGRKPSLGNQNIPLQKKQS
ADCFNASPKENKGEQQKKQEAVIKKQTTVAKPTKPSGGEFGPGRPTKPALEQKLKVNEMN
FQQKSDKGTIQKRPVASQQNKLRHSDEDAVQVKLEATKRKLQERYQEAEKAKRQRTIQVM
ELRDIPKKGPNQGVGLKNAHMRPGNNNRHWTNGRR
Download sequence
Identical sequences K4D2Y0
Solyc10g080930.1.1 XP_004249321.1.44838 Sopim10g080930.0.1 Solyc10g080930.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]