SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc11g005120.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc11g005120.1.1
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily SRF-like 8.11e-31
Family SRF-like 0.00023
Further Details:      
 
Weak hits

Sequence:  Solyc11g005120.1.1
Domain Number - Region: 111-190
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0607
Family BAR domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc11g005120.1.1
Sequence length 238
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch11 gene_region:107329-109329 transcript_region:SL2.40ch11:107329..109329- go_terms:GO:0005515,GO:0003700 functional_description:"MADS-box transcription factor 29 (AHRD V1 **** B6TVD9_MAIZE); contains Interpro domain(s) IPR002100 Transcription factor, MADS-box "
Sequence
MGRGKIEVKRIENKTSRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSTKGKLFEYTTQ
PHSMGEIINKYLQTTGASLPIHDHRVEQYDEITKMKRETLNLELSLQRYKGDELNSAQYD
ELNELEKQLENSINKIRARKLELLQQQMENLKRTEKMLEKENHDMCQWLMKYEMYKQQPV
AMMEQQEEAAITELNLLGEQPLLSQFSFFGDQHQLGTTSNSSAYHLQTSHPFTPSTYD
Download sequence
Identical sequences K4D4C5
XP_019066630.1.44838 Sopim11g005120.0.1 Solyc11g005120.1.1 Solyc11g005120.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]