SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc11g005450.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc11g005450.1.1
Domain Number 1 Region: 118-201
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 5.36e-20
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc11g005450.1.1
Sequence length 349
Comment evidence_code:10F1H1E1IEG genomic_reference:SL2.40ch11 gene_region:359146-361493 transcript_region:SL2.40ch11:359146..361493- go_terms:GO:0005634 functional_description:"Transcription elongation factor A protein 3 (AHRD V1 *--- TCEA3_BOVIN); contains Interpro domain(s) IPR010990 Transcription elongation factor, TFIIS/elongin A/CRSP70, N-terminal "
Sequence
MDLDEFRLILSESKVDVWTMMDAAISVAAVDCADELKRRRDGIVEKLYFTRSRSSDDVGN
GQHRLDNGTRNVEMMMNKSPLTPESNQREKENSNDKNEEEEDADPYGGLFDDDDEQTQIL
TIKQQLENPQLSDEDVVDLLQNLADMDITFQALQDTDIGRHVNQLRKHPSSEVRRLVKML
VRKWKGTVDDWVRLNPPEQHESANLIAADDDSPQQSVRRNQQNGNHQVPDFAYSPNPRNG
SSSSDRNNSESEYKPKPVPQRNVTPTRPLQSAPKPVSAPPPSRPLPRESAIDIERLNSAR
RRLQENYQEAQNAKKQRTIQVMDIHEIPKPKNGFIAKNKGGFQSRHHHR
Download sequence
Identical sequences K4D4F8
Solyc11g005450.1.1 Sopim11g005450.0.1 XP_004249876.1.44838 Solyc11g005450.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]