SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc11g045350.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc11g045350.1.1
Domain Number 1 Region: 883-970
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.27e-22
Family PB1 domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc11g045350.1.1
Sequence length 986
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch11 gene_region:37656830-37662843 transcript_region:SL2.40ch11:37656830..37662843+ go_terms:GO:0003700 functional_description:"Nodule inception protein (Fragment) (AHRD V1 *-*- B4ER14_MEDTR); contains Interpro domain(s) IPR003035 Plant regulator RWP-RK "
Sequence
MERGVDFWASPKGQMEGVASFDASTRSSNVDSFNNVMEIMNLDAYAGWCTSPSAAEHMLA
SYAAFSPINHMSQSYAPFEGLSYTEQNSGAFPPMDANMVVSNHDGGEKMMFGQTDDQLHF
MVDSVDGEDGLGAKRSRRSSQPSDGADIGNSMIPRSPSQPLAERMLRALAMFKESSAAGI
LAQVWIPMKNGDQYVLSTCEQPYLLDQVLSGYREVSRKFTFDTEIKPGAIPGLPGRVFSS
RIPEWTSNVLYYKEAEYLRVQYAVNHEVRGSIALPVFEDDACETPCCAVLELVTMKEKRN
FDLEMDHVCQALQAVNLRSTAPPRLHSQNLSNNQKDALAEITDVLRAVCHAHKLPLALTW
IPCNVTEGEGDEPIRVRARGCNTSLNEKCVLCVEDTACYVSDKEMQGFVHACMEHFLEEG
EGIVGKALQSNHPFFYPDVKEYHISEYPLVHHARKFGLNAAVAIRLRSTFTGNDDYILEF
FLPTSMKGSTEQQLLLNNLSGTMQRICKSLRTVADVELVGQDTKFGLQDGSVPNLPPIAL
SRKNFQHSLDSNSNSVNEAPLGACDSKSAGTHADDSHEQTMTGSRRQIEKKRSTAEKHVS
LSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKVNRSLKKIQTVLESV
QGVEGGLKFDPASGGLVPAGSITQDFDAQRSIFFPFKDVSVKNPTSVFQDTVSVPSSSGN
DKENSMVKMEEDFFADGNQLSQSNHVNTSSFKEVTKSSIEVSGYCYESKLPLTDSGNASL
GPFLSKGGCRRWGLNNDTLDNVDCQFTSQCSYSMAVGSDVDSKMKEDNEMDGDGGVIEHN
QASSSAMTDSSNGSESMINGSSSSTHSRGAEKHSKIEVNCGDNGSTITVKATYKEDTIRF
KFDLSAGCFQLYEDIAKRFKLHTETFQLKYLDEEEEWVMLVNDADLHECLEILDFSGGRT
VKFLVRDTPCALGSSGSSNCFLASGS
Download sequence
Identical sequences K4D8J9
Solyc11g045350.1.1 Solyc11g045350.1.1 XP_004250776.1.44838 XP_010313114.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]