SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc12g055950.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc12g055950.1.1
Domain Number 1 Region: 119-229
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000392
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc12g055950.1.1
Sequence length 235
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch12 gene_region:47296101-47301387 transcript_region:SL2.40ch12:47296101..47301387- functional_description:"Unknown Protein (AHRD V1); contains Interpro domain(s) IPR011993 Pleckstrin homology-type "
Sequence
MGDGPRGIEVFEDHFQASTSGEDPMHSPDLSKYIGSNDSLRSISRSWTRRKLKGAASILN
MFSLNKLPWMSGTDGQEKVVLTAAEVESLRSELGALEEREAHCKAQLEHIDEVVRAARLS
GYLDMRMRWATLPGEPLPVDDTDVDDWLPRFFVLQGSCIFWYSSCTDLSPQDSTLLSDVV
EVGTLPCLIRDNEDKRYCFYISTRYGLKYECSSISKIKVDSWLEALQSDCKLRSD
Download sequence
Identical sequences K4DFS6
Solyc12g055950.1.1 Solyc12g055950.1.1 XP_004252611.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]