SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc12g089320.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc12g089320.1.1
Domain Number 1 Region: 61-155
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.000000732
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc12g089320.1.1
Sequence length 971
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch12 gene_region:62888275-62891286 transcript_region:SL2.40ch12:62888275..62891286- functional_description:"Bromo-adjacent homology (BAH) domain-containing protein-like (AHRD V1 *-*- Q6Z809_ORYSJ)"
Sequence
MKLEDFFTLTEMSNGLTTPSRVQELLSIMQKERECDVKNAGEITKQWSAVASTIAATENK
ECLELFIQLDGLSFIQSWLRDALRFGNETGEYFVDESISHLIDLLLRAVERLHVDDKKSV
SSGIWLTVKSLLGHNNSKVQERAKTLLDSWNNGKDDCMVSAGIEKVQASINDKTRDTANL
VGENGPSEQSSVEGGSGEEKTKEHVGNSRTLSSRSDIHQSRIGDTATSNQNLEHTHMKDA
FPGSSLSNSVTEGVKGEHPAHHAECATNAIDTSNASTSIELRPGPVDEQADVPVSDSINH
SSHIKEVGGFEKFNSAVSKSLEDRTISLVTDIREALDAIAGSDLQKQTDVYNEKICSGNS
TFGDVSVAVPKGKTPVDDSKPDNHGSSKIVLEAKENSKCNNDVLQDSDKHNLEHPIDSVV
GQADKHTSDNSEDKHTSDNSEDDMENESEFQEAGKGGRDNGVFGKKSDIDFDYGIMDPLE
LARQVAIEVEREVQSCSSSEKIEESKIHEPGSPVSVSAKQSQKRIECSNKEVSRGMAPST
EASLANSEVRPINGTVKVESSQVVDATLDLETNVDKGLCTFDLNLEVCSDDMDRTLGWKG
SAATSAFRPASPRRIPGGEKAVSSGGNASSSKQMQCFHDIDLNVSEGGDDRVADLFPEKK
VSLSSALPLGKSSREASPRKSEMLEWDLNCASEEGEAPSDWRMEGSLLSLRNGHPSQSPS
SSSSSKQPSLRNFDLNDQSSFLNDFSNLNNFKKPPQNSNASGGIKSGDTVVSIMGVKVEV
NRKDYAAQSSPFPNGRVAENAVEHNVARGGGVLGMGSPFQYTPLPAFGYSGIAPVPPAFS
SSMYGPSGHIPYLVDSRGAPVVPQIGGSTSAIPPSFSQQSFILNMGSAPVPNGVWPSRSG
LDLDTGLVLDRGNKDTGGLRQLFDQGQARTMDEQFRIGMQPSTSLSIGGKRKEPDGGWES
SPFKHHPPPWK
Download sequence
Identical sequences K4DH03
Solyc12g089320.1.1 Solyc12g089320.1.1 Sopim12g089320.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]