SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CGD0016267 from Theobroma cacao Matina 1-6 v0.9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CGD0016267
Domain Number - Region: 270-369
Classification Level Classification E-value
Superfamily TPR-like 0.00455
Family Tetratricopeptide repeat (TPR) 0.083
Further Details:      
 
Domain Number - Region: 89-188
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0379
Family Pseudo ankyrin repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CGD0016267
Sequence length 483
Comment aalen=483,57% Dbxref=vitis:XP_002275605.1,prunus:ppa016777m.2
Sequence
MPILSLSRFISISISSKPNKIFTFLFSTASSADKFFTHLQKKQSNIEKTLALVNSKLDSN
CVCEVLERCCFDKSQMGLRFFIWAGLQSNYRHSSYMYSKACEFLKIKQNPFLVLDVIEAY
KVEKCLVNVKMFKVVLNLCREARITDEALLVLRKMPEFNLRPDTTTYNVVIRLICEKGDM
DMADKLMKDMGLIDLYPDMITYLAMIKGFCNAGRLEDACGLFQVMREHGCFPNAVAYSAL
LEGICRYGSVEKALELLGEMEKEGDGCSPNVITYTSVIQSFCEKGQTTKALRVLDRMGTC
GCAPNRVTVSTLIKRLCAEGHVEEAYKLIDKVVPGGGVSDGDCYSSLVVSLIRIKRLDEA
EKLFRKMLATGAKPDSIACSIMIREICQEGRVLDGFYLYEEIERMRYLSSIDADIYSILL
VGLCRQSHSVEAAKLARSMLEKRIRLKAPYVDKIIEHLKNCGDKQLVTELGRIGRILFRM
ILV
Download sequence
Identical sequences A0A061G4E0
CGD0016267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]